Si deseas distinguir tus productos, servicios o ambos de los de otra empresa, es posible que necesites una marca o nombre comercial. Descubre qué son, en qué consiste su procedimiento de registro y qué implica.
Información sobre los plazos de presentación de solicitudes de transformación de marcas de la Unión Europea en marca nacional española. Más información
Si tienes un nuevo dispositivo, producto o procedimiento que resuelva un problema técnico o tenga una ventaja práctica, existen distintas formas de protegerlo en España y en otros países. Descubre cómo hacerlo.
¿Tu innovación reside en la estética, la ornamentación o la apariencia de tu producto? Protégela mediante un diseño industrial. Descubre qué derechos confiere el registro y cómo realizar la tramitación.
Las patentes publicadas en todo el mundo son una valiosa fuente de información científica, técnica y comercial.
El Bono 3 del Fondo para pymes 2025, que cubre la elaboración de Informes Tecnológicos de Patentes (ITP) y Búsquedas Retrospectivas se cerrará el miércoles 18/06/2025 al final de la jornada laboral. Puede consultar más información aquí.
Si eres emprendedor/a o una empresa y quieres potenciar y mejorar la rentabilidad de tu negocio protegiendo de forma adecuada los activos intangibles de tu organización, en este espacio encontrarás lo necesario.
104
resultados
Última actualización
21/06/2025 [08:47:00]
Resumen de: US2025197392A1
The present invention relates to crystalline forms of an inhibitor of menin/mixed lineage leukemia (MLL) protein-protein interaction. The present invention also relates to pharmaceutical compositions comprising crystalline forms of an inhibitor of menin/mixed lineage leukemia (MLL) protein-protein interaction. These crystalline forms and pharmaceutical compositions comprising said crystalline forms may be useful for treating diseases such as cancer.
Resumen de: AU2023405289A1
The present invention relates to a CD229 and a BCMA targeting moiety, wherein the CD229 targeting moiety is an antibody, F(ab')2, Fab, scFab or scFv. The present invention further provides CARs, nucleic acid, cells, pharmaceutical compositions and kits comprising the CD229 and BCMA targeting moiety. Methods of treatment of a CD229-positive cancer, preferably Multiple Myeloma, are also provided.
Resumen de: US2025195653A1
The present disclosure relates to methods for treating or preventing a leukemia or a myelodysplastic syndrome in a subject in need thereof, said method comprising administering to the subject an effective amount of a combination comprising: (i) a binding protein comprising a first antigen binding domain (ABD) with binding specificity to CD123 and a second (ABD) with binding specificity to NKp46; and one or both of: (ii) a BCL-2 inhibitor, and (iii) a DNA hypomethylating agent.
Resumen de: US2025195678A1
The present application relates to a conjugate comprising an amatoxin, a target-binding moiety wherein the target is CD20, i.e., a CD20-binding moiety, and optionally a linker linking said amatoxin and said CD20-binding moiety. The invention further relates to the synthesis of said conjugate. In addition, the invention relates to a pharmaceutical composition comprising such conjugate, particularly for use in the treatment of B-cell and/or lymphoma associated diseases and/or malignancies.
Resumen de: US2025195646A1
The present disclosure describes a pharmaceutical combination of an anti-CD19 antibody and a phosphoinositide 3-kinase inhibitor for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
Resumen de: WO2025128434A1
The disclosure describes T cells that express chimeric antigen receptors (CARs), as well as pharmaceutical compositions comprising T cells and methods of making and using such T cells. Particularly, this disclosure describes T cells expressing a CAR that binds to CD64, and methods of use in treating acute myeloid leukemia.
Resumen de: US2025197471A1
Provided are adoptive cell therapy methods involving the administration of doses of cells for treating B cell malignancies. The cells generally express recombinant receptors such as chimeric antigen receptors (CARs). In some embodiments, the methods are for treating subjects with chronic lymphocytic leukemia (CLL). In some embodiments, the methods are for treating subjects with non-Hodgkin lymphoma (NHL). In some embodiments, the methods involve prior administration of a lymphodepleting therapy, such as prior administration of fludaribine and/or another lymphodepleting chemotherapeutic agent, for example cyclophosphamide. In some embodiments, features of the methods include an increase in complete remission, overall survival and/or progression free survival of subjects treated in accord with the provided methods.
Resumen de: US2025197495A1
Provided are methods for clinical treatment of hematological malignancies, such as relapsed or refractory chronic lymphocytic leukemia or lymphoma using an anti-LAG-3 antibody. Particular malignancies include, e.g., chronic lymphocytic leukemia (CLL), Hodgkin lymphoma (HL), or non-Hodgkin lymphoma (NHL).
Resumen de: US2025195696A1
In some aspects, the disclosure relates to compositions and methods useful for maintaining or improving retinal function and/or morphology. The disclosure is based, in part, on isolated nucleic acids encoding certain neurotrophic factors (e.g., leukemia inhibitory factor (LIF), etc.) and gene therapy vectors (e.g., recombinant adeno-associated virus (rAAV) vectors) encoding the same. In some embodiments, isolated nucleic acids and gene therapy vectors described by the disclosure are useful for treatment of certain diseases or disorders of the eye, for example retinal degeneration, retinitis pigmentosa (RP), age-related macular degeneration (AMD), glaucoma, etc.
Resumen de: US2025195666A1
The disclosure provides, inter alia, compounds comprising Toll-like receptor 9-binding nucleic acid sequences and nucleic acid sequences comprising a microRNA-142 passenger strand sequence hybridized to a microRNA-142 guide strand sequence; pharmaceutical compositions comprising the compounds; and the use of the compounds and pharmaceutical compositions to treat myeloid leukemia.
Resumen de: US2025195616A1
Disclosed in a method of treating a myeloid neoplasm, acute leukemia, or infectious disease in a subject, the method including administering to a subject in need thereof a pegylated interferon-α at a regular interval of every 2 to 8 weeks at a first dose of 250 to 500 μg.
Resumen de: AU2023406508A1
The present disclosure provides methods of treating acute myeloid leukemia (AML) and methods of determining responsive to AML treatment regimes, the methods comprising identifying the presence or absence of monocytic leukemia stem cells (m-LSCs), including CD70+ m-LSCs, in a sample from a subject.
Resumen de: US2025195498A1
The present invention relates to an inhibitor of the Helicobacter pylori (H. pylori) cell purine nucleotide salvage pathway (reserve pathway) for use in the treatment of H. pylori infection and/or the treatment or prevention of a disease associated with this infection, such as gastritis and duodenitis, gastric and duodenal ulcers, as well as gastric cancer and MALT-type lymphoma, as well as pancreatic cancer or neurodegenerative diseases or disorders. The present invention also provides a pharmaceutical composition comprising such an inhibitor of the H. pylori cell purine nucleotide salvage pathway and at least one pharmaceutically acceptable excipient. The present invention further provides a pharmaceutical composition comprising such an inhibitor of the H. pylori cell purine nucleotide salvage pathway, at least one pharmaceutically acceptable excipient and at least one additional drug for the treatment of H. pylori infection, selected in particular from an antibiotic, a proton pump inhibitor and a bismuth salt.
Resumen de: US2025195472A1
An indole alkaloid, specifically the alkaloid (3S,3aR,8aS)-3-butyl-5-hydroxy-3,3a,8a-trimethyl-3,3a,8,8a-tetrahydro-2H-furo2,3-bindole-2-one, with the generic name Andranone, as an antineoplastic agent against neoplastic cells of colon cancer, breast cancer, leukaemia, central nervous system cancer, prostate cancer, lung cancer and cervical cancer.
Resumen de: US2025197528A1
The present disclosure relates to multifunctional binding proteins comprising a first and a second antigen binding domains (ABDs) and all or part of an immunoglobulin Fc region or variant thereof, wherein the first ABD binds specifically to human BCMA and the second ABD binds specifically to human NKp46 and wherein all or part of the immunoglobulin Fc region or variant thereof bind to a human Fc-γ receptor.The disclosure also relates to methods for making said binding proteins, compositions thereof, and their uses, including the treatment or prevention of proliferative disorders, including multiple myeloma (MM).
Resumen de: US2025197510A1
The present invention provides novel human fms related tyrosine kinase 3 (FLT3) antigen binding proteins, such as antibodies, having improved FLT3 binding affinity, and/or anti-tumor activity. The FLT3 antibodies of the invention were generated by mutation of a parent FLT3 antibody and tested in in vitro in binding assays as well as in vivo in a mouse tumor model and in human patient tumor samples. The antibodies of the invention are provided as monospecific constructs or in a bispecific FLT3xCD3 antibody format and show excellent target affinity and/or tumor cell killing. The present invention also relates methods for producing the antigen binding proteins of the invention as well as nucleic acids encoding them, vectors for and host cells for their expression. The invention further relates to methods of treating or diagnosing a disease such as leukemia using an FLT3 antigen binding protein (ABP) of the invention.
Resumen de: EP4570321A2
The present disclosure relates to topical treatment of skin diseases, such as psoriasis, atopic dermatitis, alopecia, vitiligo, Reiter's syndrome, pityriasis rubra pilaris, epidermolysis bullosa simplex, palmoplantar keratoderma, pachyonychia congenita, steatocystoma multiplex, cutaneous lichen planus, cutaneous T-cell lymphoma, hidradenitis suppurativa, contact dermatitis, ichthyosis, and a disorder of keratinization, using (a) a JAK inhibitor, or a pharmaceutically acceptable salt thereof, and (b) vitamin D3, a vitamin D3 analog, or a pharmaceutically acceptable salt thereof.
Resumen de: WO2025120113A1
Provided herein are methods of treating and/or managing multiple myeloma, which comprise administering to a patient 3-(4-((4-(morpholinomethyl)benzyl)oxy)-1-oxoisoindolin-2-yl)piperidine-2,6-dione ("Compound A"), or an enantiomer or a mixture of enantiomers, a tautomer, an isotopolog, a pharmaceutically acceptable salt, solvate, hydrate, co-crystal, clathrate, or polymorph thereof, in combination with a bispecific antibody comprising a first binding part binding to B cell maturation antigen (BCMA) and a second binding part binding to cluster of differentiation 3 (CD3).
Resumen de: WO2025120219A2
The invention provides a CD16a-binding polypeptide, which comprises at least one motif that binds to CD16a, wherein said polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; the CD16a-binding polypeptide further comprising at least one additional functional portion, wherein the at least one functional portion comprises an additional binding moiety which is a binding partner recognising a protein in the B7 family and which is a polypeptide, peptide or small molecule. The invention also provides pharmaceutical compositions comprising the CD16a- binding polypeptide, and the use of the CD16a-binding polypeptide or pharmaceutical compositions as a medicament, particularly for use in the treatment or prophylaxis of cancer, such as multiple myeloma.
Resumen de: WO2025120218A1
The invention provides a CD16a-binding polypeptide which comprises at least one motif that binds to CD16a, and wherein said CD16a-binding polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; wherein the CD16a-binding motif sequence is: QQIAQYEIRRLPNLNHHQTFAFIKSLL (SEQ ID NO: 1). The invention also provides a CD16a-binding polypeptide which comprises at least one motif that binds to CD16a, and wherein said CD16a-binding polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; wherein the sequence of the CD16a-binding polypeptide is: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2). The invention also provides a CD16a-binding polypeptide which comprises the following structure: BCMA-binding polypeptide-Linker 1-BCMA-binding polypeptide-Linker 2-CD16a-binding polypeptide, wherein: each of the BCMA-binding polypeptides comprises the sequence: VDNKFNKENQFADEEIAALPNLNFYQKWAFIRKLMDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 4); the CD16a-binding polypeptide comprises the sequence: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2) or comprises the sequence: VDNKFNKEQQIAQYEIRKLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 3); and wherein each of Linker 1 an
Resumen de: AU2023373360A1
A method for assessing responsiveness of a subject to a treatment comprising T cells expressing a bivalent BCMA-targeting chimeric antigen receptor (CAR), comprising administering to the subject the T cells, and assessing the responsiveness of the subject to the treatment based on time length the subject maintains minimal residual disease (MRD) negative status.
Resumen de: WO2025122791A1
Provided herein are methods and uses for treating multiple myeloma (such as Newly Diagnosed Multiple Myeloma) in a patient in need thereof. The methods comprise administering to the patient an anti-CD38 antibody, bortezomib, lenalidomide, and dexamethasone.
Resumen de: AU2023373683A1
Methods of treating non-Hodgkin lymphoma by administering a multispecific antibody to a patient in need are provided. Methods of making such antibodies, and compositions, including pharmaceutical compositions, comprising such antibodies, are also provided.
Resumen de: WO2025122985A1
Provided herein are methods of treating acute myeloid leukemia (AML) in a subject in need thereof, comprising administering to the subject combinations of Compound 1, or a pharmaceutically acceptable salt thereof, venetoclax, and 5-azacitidine. Also provided herein are methods of inhibiting/overcoming resistance of AML to venetoclax in a subject in need thereof, and/or improving the efficacy of venetoclax in the treatment of AML in a subject in need thereof, comprising administering to the subject combinations of Compound 1, or a pharmaceutically acceptable salt thereof, venetoclax, and 5-azacitidine.
Nº publicación: WO2025119248A1 12/06/2025
Solicitante:
DU XINYUN [US]
HUANG QIANG [CN]
\u675C\u5FC3\u8D5F,
\u9EC4\u5F3A
Resumen de: WO2025119248A1
A compound represented by formula (I) as a PCNA inhibitor, or a pharmaceutically acceptable salt thereof, or a deuterated compound thereof, a preparation method therefor, an intermediate compound thereof, a pharmaceutical composition thereof and the use thereof. The PCNA inhibitor and the pharmaceutical composition comprising same can be used for treating cancers, comprising lung cancer, melanoma, colon cancer, rectal cancer, prostate cancer, ovarian cancer, leukemia, etc with PCNA overexpression.
BOPI
Sede Electrónica
