Absstract of: US12569492B1
Disclosed herein are methods for the treatment of cancer and inflammatory-based diseases and disorders, such as coronavirus colds and as a therapy against COVID-19. ImmunoFolate has been shown to reduce the incidents of colds and flus. In one embodiment is a method of treating cancer comprising administration of ImmunoFolate. In another embodiment is a method of treatment inflammatory-based disease and disorders comprising administration of ImmunoFolate.
Absstract of: WO2026047603A1
Disclosed herein are compositions comprising protein antigens and RNA encoding the same (eg., compositions comprising protein antigens and RNA encoding antigens) that can be used to induce an immune response against SARS-CoV-2. Also disclosed herein are immunogenic compositions and medical preparations comprising the same, and methods of making and using the same. In some embodiments, the technologies provided herein can be used to address and/or overcome immune imprinting in SARS-CoV-2.
Absstract of: WO2026047716A1
The present disclosure relates generally to receptor binding domain of SARS-CoV- 2 and nucleic acids encoding the receptor binding domain, wherein the receptor binding domain comprises one or more mutations at amino acid positions selected from the group comprising R28T, K38V or T, K126T, F138L, A157V, V165del, E166A or K or P, Q175E, S176P, A202G, or a combination thereof compared to SEQ ID NO: 1. Such a receptor binding domain can be included as one of the components or constituents of polypeptide or multisubunit peptide disclosed herein, including the nucleic acids encoding them.
Absstract of: US20260061046A1
Disclosed is a combination vaccine for prevention of influenza and novel coronavirus infections. The combination vaccine for vaccination against influenza and novel corona viruses was obtained by inactivating all influenza virus particles and all novel coronavirus particles respectively, thereby inducing the antibodies to each virus without affecting each vaccine effect, so that the defensive effects were obtained against the attacks of each virus. In addition, the combination vaccine with this combination exhibited favorable neutralizing antibody induction and defensive effects to the attacks of these viruses even without addition of an adjuvant.
Absstract of: CN121574211A
The invention provides a novel coronavirus recombinant subunit antigen as well as a preparation method and application thereof in vaccines. Specifically, the invention provides a novel coronavirus recombinant subunit antigen, and a corresponding recombinant protein, coding polynucleotide, a vector, a host cell, an immune antigen, a pharmaceutical composition and the like thereof, and also provides a preparation method and application. The novel coronavirus recombinant subunit antigen and the recombinant protein thereof provided by the invention have high conservative property aiming at the coronavirus and a new crown mutant strain, contain rich effective T cell epitopes, and can stimulate an organism to generate an antigen-specific antibody and cellular immune response. The novel coronavirus recombinant subunit antigen and the recombinant protein thereof can utilize an eukaryotic expression system as an expression vector, have the advantages of high yield, high protein purity, similar state to physiological state and the like, and are suitable for large-scale preparation and development of broad-spectrum new crown vaccines.
Absstract of: US20260055061A1
Halophthalimides are disclosed. The halophthalimides may inhibit TNF-α activity, TNF-α synthesis, inflammation, inducible nitric oxide synthase, SARS-CoV-2 virus, or any combination thereof. The halophthalimides may be administered to a subject with a traumatic brain injury, an inflammatory disorder, an autoimmune disorder, a neurodegenerative disease, a viral infection, or any combination thereof. The disclosed halophthalimides have a structure according to Formula I, or a stereoisomer or pharmaceutically acceptable salt, solvate, or hydrate thereof,where R5 isAt least one of R2-R4 or Re is halo.
Absstract of: US20260053741A1
The invention relates to a product for treating viral diseases, such as COVID-19, via the nasal route. The product comprises a hydrogel based on water, glycerol and a carbomer.
Absstract of: WO2026040166A1
The present invention belongs to the technical field of bioinformatics, and relates to a machine-learning-based method for screening cross-differentially expressed genes between lung cancer and COVID-19 infection and correspondingly screening prognostic genes of lung cancer. The method comprises: acquiring cross-differentially expressed genes between lung cancer and COVID-19; screening the cross-differentially expressed genes between lung cancer and COVID-19 infection; using Cox regression and LASSO regression to correspondingly screen prognostic genes of lung cancer; and using a K-M survival analysis method, GO and KEGG enrichment analysis methods and a protein-protein interaction analysis method to analyze screened-out prognostic genes of lung cancer. The method provided herein can process data, and can also identify intricate patterns in the data, and has relatively high sensitivity and specificity, thereby improving the efficiency and accuracy of screening. The technique can be extended to the research of other diseases, and features universality.
Absstract of: US20260053779A1
Disclosed are pharmaceutical formulations and methods using Verteporfin, Ribavirin, and/or Gemcitabine for use in the treatment of diseases by various routes of administration including inhalation, intratumoral, topical and/or systemic injection administration. This invention relates more specifically to the use of Verteporfin, Ribavirin, Gemcitabine, and/or combinations thereof as an inhaled dry powder treatment for COVID-19 and/or other lung infections, cancer and other non-cancer applications, which may be followed by other treatment regimens including radiation therapy, photodynamic therapy, and/or sonodynamic therapy. These pharmaceutical compositions containing one or more of Verteporfin, Ribavirin, and Gemcitabine may be included in pharmaceutical kits containing the compositions, and to methods for the treatment of cancer and non-cancer diseases with the active agents of the pharmaceutical compositions. The administering of Verteporfin alone or in combination with Ribavirin and Gemcitabine may be followed or co-administered with photodynamic and/or sonodynamic therapy (PDT/SDT).
Absstract of: AU2024333842A1
The present invention relates to polypeptides, polynucleotides, compositions, microorganisms, vectors and vaccine compositions optimised for the treatment or prophylaxis of a disease or infection caused by Betacoronaviruses, including but not limited to: Embecovirus, Hibecovirus, Merbecovirus, Nobecovirus, Sarbecovirus, MERS-CoV, SARS-CoV-1 and SARS-CoV-2. In particular, the invention provides a vaccine composition comprising a polypeptide, wherein the polypeptide comprises one or more epitope sequences, wherein the one or more epitope sequences have the amino acid sequences of any one or more of the sequences of Table 1, or a variant thereof having at least 70% sequence identity thereto, and wherein the polypeptide sequence is no more than 1400 amino acids in length.
Absstract of: US20260053745A1
Methods for prophylaxis, treatment, and reduction of infection, re-infection, and transmission rates of Coronaviruses and more particularly Coronavirus Disease 2019 (COVID-19) resulting from a SARS-CoV-2 viral infection with the use of a pharmaceutical preparation comprising one or more coated or uncoated digestive enzymes, such as pancreatic enzymes and porcine pancreatic enzymes are described herein.
Absstract of: WO2024218171A1
Compounds of Formula (I), pharmaceutical compositions containing them and their use in the treatment of a SARS-CoV-2 infection.
Absstract of: CN121554561A
The invention relates to the technical field of biology, and discloses a novel coronavirus infection restrictive factor and application thereof. The invention also discloses a method for inhibiting the replication of the coronavirus, which inhibits the replication of the coronavirus by up-regulating the expression level of the VHL protein or the N-terminal active fragment of the VHL protein in the host cell. The NCBI (National Center of Biotechnology Information) login number of the VHL protein is NP000542.1, and the amino acid sequence of the active fragment at the N end of the VHL protein is MPRRAENWDEAEVGAEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPR. The amino acid sequence of the active fragment at the N end of the VHL protein is shown in the description. According to the novel coronavirus infection restrictive factor and the application thereof, the replication of coronavirus can be inhibited by up-regulating the expression level of the VHL protein or the N-terminal active fragment of the VHL protein in a host cell, so that the novel coronavirus infection restrictive factor is used for preparing an antiviral pharmaceutical preparation.
Absstract of: CN121568702A
The present invention relates, inter alia, to a process for the preparation of garlic oil, to garlic oil produced using this process, to pharmaceutical compositions comprising this garlic oil and to the use of this garlic oil in the treatment of viral infections such as SARS-COV-2 and influenza A. A method of making a garlic oil comprises the steps of: a) processing a portion of a garlic plant to increase its surface area; b) aging the portion of the garlic plant for at least 18 months to provide aged garlic, the step not comprising the addition of ethanol; and c) separating garlic oil from the aged garlic. Step c) may be performed using rotating cone distillation or supercritical fluid extraction at a temperature of less than 110 DEG C or such that the pressure (atmospheric pressure) divided by the temperature (Kelvin temperature) is equal to or less than about 0.0026.
Absstract of: CN121555663A
The invention belongs to the technical field of biological detection, and particularly relates to a fluorescence-quenching labeled double-chain universal probe and a mediated amplification method and application thereof. The nucleic acid detection system comprises a fluorescence-quenching labeled double-stranded universal probe, the double-stranded universal probe is composed of two complementary oligonucleotide chains, and the nucleotide sequences of the double-stranded universal probe are shown as SEQ ID NO: 1-4. According to the pathogen nucleic acid detection method based on the universal probe and the target specific anchoring primer, a real-time quantitative PCR or isothermal amplification technology and a fluorescence resonance energy transfer mechanism are integrated, and synchronous and accurate detection of mycoplasma pneumoniae, streptococcus pneumoniae, haemophilus influenzae, influenza A virus, influenza B virus, novel coronavirus and the like is achieved. The method does not need pathogen culture, solves the problems of insufficient specificity, high cost, tedious operation and the like of a traditional detection technology, and can be applied to rapid diagnosis of clinical pathogen infection, reasonable use guidance of antibiotics and epidemiological monitoring.
Absstract of: US20260049062A1
Provided herein are compounds, pharmaceutical compositions, and methods for treating a SARS-CoV-2 infection.
Absstract of: US20260049994A1
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is the strain of coronavirus that causes coronavirus disease 2019 (COVID-19), the respiratory illness responsible for the COVID-19 pandemic. Antibodies produced from an immune response against SARS-CoV-2 infection are used to analyze prior exposure to the virus. The present invention provides methods for detecting antibodies in response to SARS-CoV-2 infection in a single multiplex immunoassay.
Absstract of: US20260049367A1
The present invention relates to a reaction mixture suitable for use in the diagnosis of Covid-19 by isothermal amplification method.
Absstract of: US20260048058A1
The present disclosure relates to methods of treating Alzheimer's disease, diseases and/or conditions associated with Covid-19 infection, including long COVID, a post-acute infection syndrome, or symptoms of orthostatic intolerance comprising administration of a therapeutically-effective combination of a COX-2 inhibitor and an antiviral compound.
Absstract of: AU2024298416A1
The present invention relates to monoclonal antibodies or antigen-binding portion thereof that have a potent neutralizing activity against Coronavirus, in particular against at least one virus selected from SARS-CoV-2, SARS-CoV-1 and variants thereof. The invention relates also to the use of such monoclonal antibodies or antigen-binding portion thereof in therapy, prophylaxis, and diagnosis of Coronavirus, in particular SARS-CoV-2 and/or SARS-CoV-1 dependent diseases.
Nº publicación: WO2026039749A1 19/02/2026
Applicant:
THE TRUSTEES OF COLUMBIA UNIV IN THE CITY OF NEW YORK [US]
WISCONSIN ALUMNI RES FOUNDATION WARF [US]
THE TRUSTEES OF COLUMBIA UNIVERSITY IN THE CITY OF NEW YORK,
WISCONSIN ALUMNI RESEARCH FOUNDATION (WARF)
Absstract of: WO2026039749A1
Described herein are soluble HRC-based Hpopeptide inhibitors of coronaviruses identified using structure-guided design to incorporate charged or polar residues at specific sites in the peptide to enhance aqueous solubility. Also described are methods of treating a coronavirus infection using soluble HRC-based hpopeptide inhibitors.