Se desexas distinguir vos teus produtos, servizos ou ambos os dous doutra empresa, é posible que necesites unha marca ou nome comercial. Descobre que son, en que consiste ou seu procedemento de rexistro e que implica.
Información sobre los plazos de presentación de solicitudes de transformación de marcas de la Unión Europea en marca nacional española. Más información
Se tes un novo dispositivo, produto ou procedemento que resolva un problema técnico ou teña unha vantaxe práctica, existen distintas formas de protexelo en España e noutros países. Descobre como facelo.
A túa innovación reside na estética, a ornamentación ou a aparencia do teu produto? Protéxea mediante un deseño industrial. Descobre que dereitos confire ou rexistro e como realizar a tramitación.
As patentes publicadas en todo ou mundo son unha valiosa fonte de información científica, técnica e comercial.
El Bono 3 del Fondo para PYMEs 2025, que cubre la elaboración de Informes Tecnológicos de Patentes (ITP) y Búsquedas Retrospectivas se cerrará el lunes 10 de febrero de 2025 al cierre de la jornada laboral. Próximamente se informará sobre su reapertura. Puede consultar más información aquí.
Ése emprendedor/a ou unha empresa e queres potenciar e mellorar a rendibilidade do teu negocio protexendo de forma adecuada vos activos intangibles dá túa organización, neste espazo atoparás ou necesario.
87
resultados
Última actualización
15/06/2025 [06:45:00]
Resumen de: WO2025122791A1
Provided herein are methods and uses for treating multiple myeloma (such as Newly Diagnosed Multiple Myeloma) in a patient in need thereof. The methods comprise administering to the patient an anti-CD38 antibody, bortezomib, lenalidomide, and dexamethasone.
Resumen de: AU2023373360A1
A method for assessing responsiveness of a subject to a treatment comprising T cells expressing a bivalent BCMA-targeting chimeric antigen receptor (CAR), comprising administering to the subject the T cells, and assessing the responsiveness of the subject to the treatment based on time length the subject maintains minimal residual disease (MRD) negative status.
Resumen de: WO2025120219A2
The invention provides a CD16a-binding polypeptide, which comprises at least one motif that binds to CD16a, wherein said polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; the CD16a-binding polypeptide further comprising at least one additional functional portion, wherein the at least one functional portion comprises an additional binding moiety which is a binding partner recognising a protein in the B7 family and which is a polypeptide, peptide or small molecule. The invention also provides pharmaceutical compositions comprising the CD16a- binding polypeptide, and the use of the CD16a-binding polypeptide or pharmaceutical compositions as a medicament, particularly for use in the treatment or prophylaxis of cancer, such as multiple myeloma.
Resumen de: WO2025120113A1
Provided herein are methods of treating and/or managing multiple myeloma, which comprise administering to a patient 3-(4-((4-(morpholinomethyl)benzyl)oxy)-1-oxoisoindolin-2-yl)piperidine-2,6-dione ("Compound A"), or an enantiomer or a mixture of enantiomers, a tautomer, an isotopolog, a pharmaceutically acceptable salt, solvate, hydrate, co-crystal, clathrate, or polymorph thereof, in combination with a bispecific antibody comprising a first binding part binding to B cell maturation antigen (BCMA) and a second binding part binding to cluster of differentiation 3 (CD3).
Resumen de: WO2025120218A1
The invention provides a CD16a-binding polypeptide which comprises at least one motif that binds to CD16a, and wherein said CD16a-binding polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; wherein the CD16a-binding motif sequence is: QQIAQYEIRRLPNLNHHQTFAFIKSLL (SEQ ID NO: 1). The invention also provides a CD16a-binding polypeptide which comprises at least one motif that binds to CD16a, and wherein said CD16a-binding polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; wherein the sequence of the CD16a-binding polypeptide is: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2). The invention also provides a CD16a-binding polypeptide which comprises the following structure: BCMA-binding polypeptide-Linker 1-BCMA-binding polypeptide-Linker 2-CD16a-binding polypeptide, wherein: each of the BCMA-binding polypeptides comprises the sequence: VDNKFNKENQFADEEIAALPNLNFYQKWAFIRKLMDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 4); the CD16a-binding polypeptide comprises the sequence: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2) or comprises the sequence: VDNKFNKEQQIAQYEIRKLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 3); and wherein each of Linker 1 an
Resumen de: AU2023373683A1
Methods of treating non-Hodgkin lymphoma by administering a multispecific antibody to a patient in need are provided. Methods of making such antibodies, and compositions, including pharmaceutical compositions, comprising such antibodies, are also provided.
Resumen de: WO2025122985A1
Provided herein are methods of treating acute myeloid leukemia (AML) in a subject in need thereof, comprising administering to the subject combinations of Compound 1, or a pharmaceutically acceptable salt thereof, venetoclax, and 5-azacitidine. Also provided herein are methods of inhibiting/overcoming resistance of AML to venetoclax in a subject in need thereof, and/or improving the efficacy of venetoclax in the treatment of AML in a subject in need thereof, comprising administering to the subject combinations of Compound 1, or a pharmaceutically acceptable salt thereof, venetoclax, and 5-azacitidine.
Resumen de: WO2025119248A1
A compound represented by formula (I) as a PCNA inhibitor, or a pharmaceutically acceptable salt thereof, or a deuterated compound thereof, a preparation method therefor, an intermediate compound thereof, a pharmaceutical composition thereof and the use thereof. The PCNA inhibitor and the pharmaceutical composition comprising same can be used for treating cancers, comprising lung cancer, melanoma, colon cancer, rectal cancer, prostate cancer, ovarian cancer, leukemia, etc with PCNA overexpression.
Resumen de: WO2025119153A1
Provided is a composition which can be a lyophilized preparation solution or a lyophilized powder preparation. The composition comprises a multispecific antibody, a surfactant, a buffer system, and a stabilizer/osmotic pressure regulator. Further provided are a preparation method for the composition and use of the composition, for example, use in treating tumors, especially multiple myeloma.
Resumen de: WO2025122939A1
There are provided methods for detecting and classifying a B-cell malignancy selected from the group consisting of a B-cell lymphoma, a B-cell leukemia, and a plasma cell dyscrasia in a subject. The methods employ a tumor cell profiling algorithm to analyze single-cell RNA sequencing data obtained from a sample of, e.g., the subject's blood or bone marrow, enriched for a cell type comprising tumoral cells using a cell surface marker. This algorithm identifies one or more one or more expanded clonal cell populations and categorizes each of the one or more expanded clonal cell populations as malignant or pre-malignant tumor cell population if expression of one or more malignancy markers is detected. The one or more malignant or pre-malignant tumor cell population(s) can be analyzed using a statistical model or machine learning algorithm to classify the B-cell malignancy.
Resumen de: WO2025122697A1
Various embodiments of the present disclosure provide determining a clinical diagnosis prediction and/or prognosis prediction with respect to acute myeloid leukemia (AML). A prediction model operating on a computing entity obtains subject data comprising DNA methylation data corresponding to a subject. The prediction model provides the subject data to an input layer of a machine learning-trained model configured to generate a clinical diagnosis prediction and/or a prognosis prediction for the subject based on a learned transformation of the subject data. The prediction model extracts at least one prediction from an output layer of the machine learning-trained model. The prediction model causes the at least one prediction to be provided for human review.
Resumen de: WO2025122569A1
Disclosed is a recombinant T cell receptor that recognizes the KMT2A: :AFF1 fusion neoantigen presented by HLA- DPAl*02 : 01 DPBl*01 : 01, polynucleotides encoding the recombinant T cell receptor, and an expression vector and recombinant host cell comprising such polynucleotides. A method of using the recombinant T cell receptor in adoptive immunotherapy for treating leukemia is also provided.
Resumen de: WO2025121806A1
The present invention relates to a pharmaceutical composition for prevention or treatment of cancer, comprising a BTK degrader and a METTL3 inhibitor, for which it has been confirmed that when a BTK degrader and a METTL3 inhibitor based on proteolysis-targeting chimera (PROTAC) technology are co-administered, a synergistic effect of exhibiting notable anticancer activity is achieved compared to when same are used alone, and thus a prevention or treatment effect on various cancers such as leukemia, lymphoma, lung cancer, pancreatic cancer, and breast cancer may be created.
Resumen de: WO2025121805A1
The present invention relates to a pharmaceutical composition for preventing or treating cancer, the composition comprising an EZH2 inhibitor and a JAK3 inhibitor. When an EZH2 inhibitor and a JAK3 inhibitor based on proteolysis-targeting chimera (PROTAC) technology are co-administered, a remarkable synergistic effect on anticancer activity is exhibited as compared to when either of the inhibitors is administered by itself. Thus, the present invention was found to be able to create a preventive or therapeutic effect on various cancers such as lymphoma, lung cancer, pancreatic cancer, breast cancer, and colorectal cancer.
Resumen de: WO2025121807A1
The present invention relates to a pharmaceutical composition for the prevention or treatment of cancer comprising an EZH2 inhibitor and a METTL3 inhibitor. When co-administered, the EZH2 inhibitor and METTL3 inhibitor based on proteolysis-targeting chimera (PROTAC) technology exhibit a synergistic anticancer effect that is significantly superior to individual treatments, demonstrating that the co-administration can bring about the effects of preventing or treating various cancers such as leukemia, lymphoma, lung cancer, pancreatic cancer, breast cancer, and colorectal cancer.
Resumen de: WO2025122271A1
Described are a method for allogeneic hematopoietic stem cell transplantation (HSCT), a method of treating leukemia, a method of preventing leukemic relapse in a patient in need thereof for at least one year after allogeneic hematopoietic stem cell transplantation comprising administration of a γδ T cell product after the allogeneic HSCT. The invention also encompasses a method of increasing in vivo persistence and expansion of allogeneic γδ T cells administered after allogeneic hematopoietic stem cell transplantation.
Resumen de: US2025188177A1
The disclosure provides anti-CD70 antibodies, antigen binding fragments thereof, chimeric antigen receptors (CARs) and engineered T cell receptors (TCRs) comprising an antigen binding molecule that specifically binds to CD70, polynucleotides encoding the same, and in vitro cells comprising the same. The polynucleotides, polypeptides, and in vitro cells described herein can be used in an engineered TCR and/or CAR T cell therapy for the treatment of a patient suffering from a cancer. In one embodiment, the polynucleotides, polypeptides, and in vitro cells described herein can be used for the treatment of multiple myeloma.
Resumen de: US2025188169A1
The disclosure provides method for treating clonal hematopoiesis disorders such as clonal hematopoiesis, myelodysplasia, and leukemia.
Resumen de: US2025189529A1
Provided herein are biomarkers and combinations of biomarkers for use in manufacturing panels for determining whether a patient is at risk for multiple myeloma precursor disease progression. Also provided herein are methods of treatment for subjects identified as being at risk for multiple myeloma precursor disease progression.
Resumen de: US2025186460A1
The present disclosure provides anti-CD19 antibodies and venetoclax for use in the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or small lymphocytic lymphoma. The anti-CD19 antibodies, in particular MOR00208, and venetoclax are administered to patients suffering non-Hodgkin's lymphoma (NHL), chronic lymphocytic leukemia (CLL) and/or small lymphocytic lymphoma (SLL) according to a specific treatment paradigm to mitigate therapy associated tumor lysis syndrome.
Resumen de: WO2025121944A1
The present invention discloses antibodies specifically binding to canine CD20 and uses thereof. The antibody according to the present invention can be used for early diagnosis, disease progression monitoring, and treatment of B-cell lymphoma in dogs.
Resumen de: US2025189516A1
The present invention relates to a method, in particular an in vitro method, for identifying an improved anti-senescence compound based on detecting the binding of said compound in the presence of at least one phosphory lated amino acid in the transcription activation domain (TAD) domain of mammalian protein p53. The present invention further relates to a method, in particular an in vitro method, for monitoring an anti-senescence treatment or prophylaxis in a mammalian subject in need thereof, based on detecting the amount of phosphorylation of amino acids in the TAD and/or C-terminal region of the mammalian p53 protein in a biological sample obtained from said subject and/or detecting the amount and/or co-localization with phosphorylated p53 of the promyelocytic leukemia protein (PML) bodies in a biological sample obtained from said subject. Furthermore, the present invention relates to a kit for performing the above methods as well as respective uses thereof. Finally, improved anti-senescence compounds or pharmaceutical compositions are provided.
Resumen de: US2025186477A1
The present disclosure provides compositions (e.g., injectable compositions) comprising fludarabine (e.g., fludarabine phosphate), and methods of using same to treat cancers, such as a lymphoma, and/or to lymphodeplete a subject in need thereof, for example in association with a CAR-T therapeutic regimen.
Resumen de: US2025186451A1
The present disclosure relates generally to use of a compound of formula (I), also named ASTX660 in combination therapies for treating cancer, in particular leukemia.
Nº publicación: US2025186492A1 12/06/2025
Solicitante:
PERSONGEN BIOTHERAPEUTICS SUZHOU CO LTD [CN]
PERSONGEN BIOTHERAPEUTICS (SUZHOU) CO., LTD
Resumen de: US2025186492A1
The present invention provides a CAR-T cell targeting B7-H3 and an application thereof in the treatment of acute myeloid leukemia (AML). Specifically, the present invention provides a CAR-T cell targeting B7-H3, which comprises an scFv which targets B7-H3, a 41BB costimulatory signaling molecule and a CD3ζ domain. The B7-H3-CAR-T cell of the present invention has significant specific killing toward B7-H3 positive AML tumor cells. The results of animal experiments show that the B7-H3-CAR-T cell can significantly inhibit the growth of AML tumor cells in mice, significantly prolong the survival period of mice, and has a significant anti-tumor effect in vivo. The B7-H3-CAR-T cell of the present invention can be used as a novel therapeutic method for the targeted treatment of AML, and has huge clinical application prospects.
BOPI
Sede Electrónica
